SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000470557 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470557
Domain Number 1 Region: 202-275
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-17
Family DBL homology domain (DH-domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470557   Gene: ENSG00000076928   Transcript: ENST00000594521
Sequence length 275
Comment pep:novel chromosome:GRCh38:19:41894292:41902030:1 gene:ENSG00000076928 transcript:ENST00000594521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQAEKPGATDRKGGVGMPSRDRNIG
APGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESLAPPESTDEGAETERR
WKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPSSATAVLGPARRATP
EPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRML
RVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEV
Download sequence
Identical sequences A0A2J8QGK0 M0QZH8
ENSP00000470557 ENSP00000470557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]