SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000470619 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470619
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.78e-33
Family Tyrosine-dependent oxidoreductases 0.00000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470619   Gene: ENSG00000090013   Transcript: ENST00000597870
Sequence length 154
Comment pep:known chromosome:GRCh38:19:40447821:40465735:-1 gene:ENSG00000090013 transcript:ENST00000597870 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAAD
VDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSGGWWDHGGG
AELGGTGEAAQGPLKGDAEAIPCYCAFTEHQLCA
Download sequence
Identical sequences M0QZL1
ENSP00000470619 ENSP00000470619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]