SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000470660 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470660
Domain Number 1 Region: 36-134
Classification Level Classification E-value
Superfamily Ribosomal protein S7 6.54e-39
Family Ribosomal protein S7 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470660   Gene: ENSG00000083845   Transcript: ENST00000598098
Sequence length 134
Comment pep:novel chromosome:GRCh38:19:58387264:58394804:1 gene:ENSG00000083845 transcript:ENST00000598098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQNPLQVLVNAIINSGPREDSTRIGR
AGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAI
KKKDELERVAKSNR
Download sequence
Identical sequences A0A1D5QGE5 A0A2I2UF30 A0A2I2YPF3 A0A2I3RSD7 A0A2J8RQH7 A0A2K5C6T5 A0A2K5INS2 A0A2K5LGP0 A0A2K5PQV8 A0A2K5WE08 A0A2K5XXB8 A0A2K6DB13 A0A2K6F5M9 A0A2K6K9B6 A0A2K6QCM1 A0A2K6UBL1 M0QZN2
ENSP00000470660 ENSP00000470660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]