SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471242 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471242
Domain Number 1 Region: 539-750
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-46
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 907-1059
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.24e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 736-758,790-891
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-23
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-23
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471242   Gene: ENSG00000152767   Transcript: ENST00000595437
Sequence length 1076
Comment pep:known chromosome:GRCh38:13:98142562:98449773:1 gene:ENSG00000152767 transcript:ENST00000595437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGRPGSFSLIRTPHLGQARRIPCAP
ERRPLLLVKEFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYG
MTIEESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFL
ASSPPDNKSPDEATAADQESEDDLSASRTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSI
AVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSES
ENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRPHVLSHKESLVY
Download sequence
Identical sequences C9JME2
ENSP00000410930 NP_001273768.1.87134 NP_001273768.1.92137 XP_011519348.1.92137 ENSP00000365771 ENSP00000471242 ENSP00000471242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]