SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471331 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471331
Domain Number 1 Region: 61-279,325-415
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000194
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471331   Gene: ENSG00000269881   Transcript: ENST00000600536
Sequence length 531
Comment pep:putative chromosome:GRCh38:16:249547:269943:1 gene:ENSG00000269881 transcript:ENST00000600536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDHKDLEAEIHPLKNEERKSQENLGNPSKNEDNVKSAPPQSRLSRCRAAAFFLSLFLCL
FVVFVVSFVIPCPDRPASQRMWRIDYSAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNN
FSRSCVDEGFSSPCTFAAAVSGANGSTLWERPVAQDVALVECAVPQPRGSEAPSACILVG
RPSSFIAVNLFTGETLWNHSSSFSGNASILSPLLQVPDVDGDGAPDLLVLTQEREEVSGH
LYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSG
GPFKSDPHWESMLNATTRRMLSHSSGAVRYLMHVPGNAGADVLLVGSEAFVLLDGQELTP
RWTPKAAHVLRKPIFGRYKPDTLAVAVENGTGTDRQILFLDLGTGAVLCSLALPSLPGGP
LSASLPTADHRSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA
FDGSHWATAERLLDGAELAPRPACPRLVTGVWEAARLCILLPGIRWLIYWF
Download sequence
Identical sequences B4DGG1
ENSP00000471331 ENSP00000397477 ENSP00000471331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]