SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471380 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471380
Domain Number 1 Region: 264-532
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 3.66e-87
Family ATP-dependent DNA ligase DNA-binding domain 0.000000000114
Further Details:      
 
Domain Number 2 Region: 533-751
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.45e-56
Family ATP-dependent DNA ligase catalytic domain 0.00000000198
Further Details:      
 
Domain Number 3 Region: 753-796
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000497
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471380   Gene: ENSG00000105486   Transcript: ENST00000594759
Sequence length 800
Comment pep:known chromosome:GRCh38:19:48115450:48170326:-1 gene:ENSG00000105486 transcript:ENST00000594759 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEETPKESLTEAEVATEKEGEDGDQP
TTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVKK
EVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIEE
VSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQA
TGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSASTA
KKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMV
DAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLK
PMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDI
ISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFD
LIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEG
LMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLA
SYDEDSEELQAICKVLGNWG
Download sequence
Identical sequences M0R0Q7
ENSP00000471380 ENSP00000471380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]