SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471408 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000471408
Domain Number - Region: 2-47,94-153
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000139
Family WD40-repeat 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471408   Gene: ENSG00000160410   Transcript: ENST00000597396
Sequence length 277
Comment pep:novel chromosome:GRCh38:19:40586896:40591392:1 gene:ENSG00000160410 transcript:ENST00000597396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALESADGHG
GCSAGNDIGPYGERDDQQVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLE
CEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQAPGGLTEQELMEQLEHCELAPP
APSAPSWGCLPSPSPRISLTSLHSASSNTSLSGHRGSPSPPQAEARRRGGGSFVERCQEL
VRSGPDLRRPPTPAPWPSSGLGTPLTPPKMKLNETSF
Download sequence
Identical sequences A0A2J8QFZ4 M0R0S2
ENSP00000471408 ENSP00000471408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]