SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471659 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471659
Domain Number 1 Region: 17-145
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000183
Family DPP6 N-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471659   Gene: ENSG00000142002   Transcript: ENST00000599163
Sequence length 151
Comment pep:known chromosome:GRCh38:19:4690878:4704151:-1 gene:ENSG00000142002 transcript:ENST00000599163 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
GGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTF
CHQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEVDESE
VEVIHVPSPALEERKTDSYRYPRTARIPRLP
Download sequence
Identical sequences A0A2J8JR88 A0A2J8SBZ0 M0R162
ENSP00000471659 ENSP00000471659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]