SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000471690 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471690
Domain Number 1 Region: 30-75
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-18
Family Fibronectin type II module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471690   Gene: ENSG00000169393   Transcript: ENST00000597519
Sequence length 75
Comment pep:novel chromosome:GRCh38:19:47994709:48025153:1 gene:ENSG00000169393 transcript:ENST00000597519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWSSYLLGWTTFLLYSYESSGGISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWC
ATSYNYDQDHTWVYC
Download sequence
Identical sequences M0R179
ENSP00000471690 ENSP00000471690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]