SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000471954 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000471954
Domain Number 1 Region: 11-91
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000002
Family DPP6 N-terminal domain-like 0.031
Further Details:      
 
Domain Number 2 Region: 101-141
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000172
Family Fungal lipases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000471954   Gene: ENSG00000142002   Transcript: ENST00000595327
Sequence length 141
Comment pep:novel chromosome:GRCh38:19:4685628:4690906:-1 gene:ENSG00000142002 transcript:ENST00000595327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEVLARHGSKGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFVSHYSSV
STPPCVHVYKLSGPDDDPLHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIY
KPHALQPGKKHPTVLFVYGGP
Download sequence
Identical sequences M0R1L4
ENSP00000471954 ENSP00000471954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]