SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000472643 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472643
Domain Number 1 Region: 94-223
Classification Level Classification E-value
Superfamily FKBP-like 8.64e-24
Family FKBP immunophilin/proline isomerase 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472643   Gene: ENSG00000105701   Transcript: ENST00000597611
Sequence length 257
Comment pep:known chromosome:GRCh38:19:18538216:18544077:-1 gene:ENSG00000105701 transcript:ENST00000597611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQ
PPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKG
QVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVL
AANSYDLAIKAITSSAK
Download sequence
Identical sequences M0R2K9
ENSP00000472643 ENSP00000472643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]