SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000472679 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472679
Domain Number 1 Region: 130-216
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000451
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472679   Gene: ENSG00000130751   Transcript: ENST00000602189
Sequence length 415
Comment pep:putative chromosome:GRCh38:19:47019849:47045727:1 gene:ENSG00000130751 transcript:ENST00000602189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSSVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKV
PPSSLVQERSFFVRMKSTLTKRGLHVKASGYKQVIHVTGRLRAHALGLVALGHTLPPAPL
AELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHV
DLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPL
DAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGKRIKVEPGPRETKGS
EDSGDEDPSSHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRG
LCTPGTIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Download sequence
Identical sequences M0R2M8
ENSP00000472679 ENSP00000472679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]