SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000472752 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472752
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily SNF-like 2.48e-24
Family SNF-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472752   Gene: ENSG00000063127   Transcript: ENST00000597969
Sequence length 147
Comment pep:putative chromosome:GRCh38:19:49305885:49310146:-1 gene:ENSG00000063127 transcript:ENST00000597969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYFNVVNSWIIFYMSQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDR
IEDGGSPVYSLVLPFFLCWCLVGAFMINGLKSTGKVIYVLVLLPCFIIVGFFIRTLLLEG
AKFGLQQLVVAKQRQGFTVLARTVSIF
Download sequence
Identical sequences M0R2R5
ENSP00000472752 ENSP00000472752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]