SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000472960 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000472960
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-18
Family Fibronectin type II module 0.0031
Further Details:      
 
Domain Number 2 Region: 109-154
Classification Level Classification E-value
Superfamily Kringle-like 1.17e-16
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 3 Region: 49-100
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000004
Family Fibronectin type II module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000472960   Gene: ENSG00000169393   Transcript: ENST00000593782
Sequence length 154
Comment pep:known chromosome:GRCh38:19:48015893:48025134:1 gene:ENSG00000169393 transcript:ENST00000593782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPC
IFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYK
NKNYFNCTNEGSKENLVWCATSYNYDQDHTWVYC
Download sequence
Identical sequences M0R331
ENSP00000472960 ENSP00000472960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]