SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473019 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473019
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.75e-34
Family SCAN domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473019   Gene: ENSG00000121413   Transcript: ENST00000600897
Sequence length 185
Comment pep:known chromosome:GRCh38:19:58088685:58098214:-1 gene:ENSG00000121413 transcript:ENST00000600897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEA
AGPHQTLARLHELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKA
ASLVEGLADVLEEPGMLLGSPAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPA
PSETR
Download sequence
Identical sequences M0R364
ENSP00000473019 ENSP00000473019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]