SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473175 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000473175
Domain Number - Region: 6-57
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000353
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473175   Gene: ENSG00000142002   Transcript: ENST00000597726
Sequence length 68
Comment pep:putative chromosome:GRCh38:19:4702684:4723842:-1 gene:ENSG00000142002 transcript:ENST00000597726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTFCHQGLS
NVLDDPKS
Download sequence
Identical sequences A0A2J8JR55 M0R3E8
ENSP00000473175 ENSP00000473175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]