SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000473561 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473561
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily UBC-like 6.17e-53
Family UBC-related 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473561   Gene: ENSG00000104343   Transcript: ENST00000602593
Sequence length 151
Comment pep:known chromosome:GRCh38:8:73792360:73878825:-1 gene:ENSG00000104343 transcript:ENST00000602593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKF
SSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCK
EKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
Download sequence
Identical sequences A0A0D9RM42 A0A1S3AQ18 A6H795 B5DEI4 F7IGP0 H0VD59 H3AQW5 H9YVR0 K7D6B6 K7EU56 M3WYV9 Q96B02 U6CP91
2mt6_A ENSP00000473561 001411836|e2mt6A1|216.1.1.7|A:1-151 ENSBTAP00000010872 NP_001092592.1.59421 NP_001092592.1.76553 XP_002710685.3.1745 XP_002819226.1.23681 XP_003800090.1.62490 XP_004280614.1.21590 XP_004372579.1.4749 XP_004588110.1.84141 XP_004637611.1.9945 XP_004679851.1.23501 XP_004842107.1.39548 XP_006004573.1.90931 XP_006086415.1.53796 XP_006237984.2.100692 XP_006860070.1.41390 XP_007538828.1.11023 XP_008148553.1.99482 XP_008577136.1.73410 XP_008709029.1.72690 XP_008756764.1.4139 XP_008771705.1.100692 XP_012376934.1.11602 XP_012999517.1.53824 XP_017196725.1.1745 XP_018888290.1.27298 XP_019499151.1.44202 XP_019581410.1.88060 XP_020668544.1.8467 ENSBTAP00000010872 ENSCJAP00000014130 ENSPPYP00000024080 ENSMMUP00000012765 gi|145301543|ref|NP_060769.3| ENSP00000473561 ENSDNOP00000030008 ENSLACP00000012036 ENSPPYP00000024080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]