SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000473564 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000473564
Domain Number 1 Region: 37-388
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.81e-67
Family Acetyl-CoA synthetase-like 0.0000295
Further Details:      
 
Domain Number 2 Region: 601-943
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.75e-49
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 400-455
Classification Level Classification E-value
Superfamily ACP-like 0.0000484
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000473564   Gene: ENSG00000157426   Transcript: ENST00000602986
Sequence length 945
Comment pep:known chromosome:GRCh38:4:56338287:56387508:-1 gene:ENSG00000157426 transcript:ENST00000602986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNDGKEKYEKEKIKSISSEHVNEEKAEEHMDLRLKHCLAYVLHTSGTTGIPKIVRVPHK
CIVPNIQHFRVLFDITQEDVLFLASPLTFDPSVVEIFLALSSGASLLIVPTSVKLLPSKL
ASVLFSHHRVTVLQATPTLLRRFGSQLIKSTVLSATTSLRVLALGGEAFPSLTVLRSWRG
EGNKTQIFNVYGITEVSSWATIYRIPEKTLNSTLKCELPVQLGFPLLGTVVEVRDTNGFT
IQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKR
LNIELVQQVAEELQQVESCAVTWYNQEKLILFMVSKDASVKEYIFKELQKYLPSHAVPDE
LVLIDSLPFTSHGKIDVSELNKIYLNYINLKSENKLSGKEDLWEKLQYLWKSTLNLPEDL
LRVPDESLFLNSGGDSLKSIRLLSEIEKLVGTSVPGLLEIILSSSILEIYNHILQTVVPD
EDVTFRKSCATKRKLSDINQEEASGTSLHQKAIMTFTCHNEINAFVVLSRGSQILSLNST
RFLTKLGHCSSACPSDSVSQTNIQNLKGLNSPVLIGKSKDPSCVAKVSEEGKPAIGTQKM
ELHVRWRSDTGKCVDASPLVVIPTFDKSSTTVYIGSHSHRMKAVDFYSGKVKWEQILGDR
IESSACVSKCGNFIVVGCYNGLVYVLKSNSGEKYWMFTTEDAVKSSATMDPTTGLIYIGS
HDQHAYALDIYRKKCVWKSKCGGTVFSSPCLNLIPHHLYFATLGGLLLAVNPATGNVIWK
HSCGKPLFSSPQCCSQYICIGCVDGNLLCFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIF
FGSHDCFIYCCNMKGHLQWKFETTSRVYATPFAFHNYNGSNEMLLAAASTDGKVWILESQ
SGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDLLGGNQK
Download sequence
Identical sequences R4GNB1
ENSP00000473564 NP_001273598.1.87134 NP_001273598.1.92137 XP_016863230.1.92137 XP_016863231.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]