SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000474318 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000474318
Domain Number 1 Region: 48-105
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000147
Family Kringle modules 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000474318   Gene: ENSG00000122861   Transcript: ENST00000481390
Sequence length 106
Comment pep:known chromosome:GRCh38:10:73909177:73913049:1 gene:ENSG00000122861 transcript:ENST00000481390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHA
Download sequence
Identical sequences S4R3G7
ENSP00000474318 ENSP00000474318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]