SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000474485 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000474485
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-68
Family Protein kinases, catalytic subunit 0.00000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000474485   Gene: ENSG00000156345   Transcript: ENST00000605159
Sequence length 275
Comment pep:putative chromosome:GRCh38:9:87966611:87974505:-1 gene:ENSG00000156345 transcript:ENST00000605159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMED
NQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHA
NNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGS
PLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQA
LDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Download sequence
Identical sequences A0A0S2Z5B6
ENSP00000474485 gi|282402175|ref|NP_001164110.1| ENSP00000474485 NP_001164110.1.87134 NP_001164110.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]