SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000474669 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000474669
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-36
Family ALDH-like 0.00000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000474669   Gene: ENSG00000111275   Transcript: ENST00000549106
Sequence length 117
Comment pep:known chromosome:GRCh38:12:111792611:111809670:1 gene:ENSG00000111275 transcript:ENST00000549106 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVD
ETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEGQLL
Download sequence
Identical sequences S4R3S4
ENSP00000474669 ENSP00000474669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]