SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000474981 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000474981
Domain Number 1 Region: 57-173
Classification Level Classification E-value
Superfamily Cobalamin adenosyltransferase-like 8.04e-29
Family Cobalamin adenosyltransferase 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000474981   Gene: ENSG00000139428   Transcript: ENST00000541763
Sequence length 173
Comment pep:known chromosome:GRCh38:12:109556754:109573480:-1 gene:ENSG00000139428 transcript:ENST00000541763 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYT
KTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCT
LQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILP
Download sequence
Identical sequences F5H4Z7
ENSP00000444793 ENSP00000474981 ENSP00000444793 ENSP00000474981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]