SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000476252 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000476252
Domain Number 1 Region: 170-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.65e-34
Family G proteins 0.0000019
Further Details:      
 
Domain Number 2 Region: 38-132
Classification Level Classification E-value
Superfamily PP2C-like 3.92e-17
Family PP2C-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476252   Gene: ENSG00000271810   Transcript: ENST00000606505
Sequence length 272
Comment pep:putative chromosome:GRCh38:1:112702648:112711355:-1 gene:ENSG00000271810 transcript:ENST00000606505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIELEDLRFPLVCGEGKKARVMATIG
VTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDDVLVLGTDGLWDVTTDCE
VAATVDRVLSAYEPNDHSSLDFISAPEPALSSCSLGTSAGWSPTMAAIRKKLVIVGDGAC
GKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPD
TDVILMCFSIDSPDSLENIPEKWTPEVKHFCP
Download sequence
Identical sequences ENSP00000476252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]