SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000476763 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000476763
Domain Number - Region: 2-94
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00144
Family Cgl1923-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000476763   Gene: ENSG00000128789   Transcript: ENST00000585331
Sequence length 233
Comment pep:putative chromosome:GRCh38:18:12658738:12725740:1 gene:ENSG00000128789 transcript:ENST00000585331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLR
SIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSV
QNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEG
DNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences NP_671692.1.87134 NP_671692.1.92137 ENSP00000476763 gi|312596924|ref|NP_671692.1| ENSP00000476763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]