SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000477299 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477299
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000733
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 2 Region: 188-229
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000183
Family DBL homology domain (DH-domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477299   Gene: ENSG00000116584   Transcript: ENST00000471589
Sequence length 229
Comment pep:novel chromosome:GRCh38:1:155963140:155979099:-1 gene:ENSG00000116584 transcript:ENST00000471589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCT
KVKQKQQKAALLKNNTALQSVSLRSKTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLA
KSVSTTNIAGHFNDESPLGLRRILSQSTDSLNMRNRTLSVESLIDEAEVIYSELMSDFEM
DEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVIYELIQTELHHVRTLKI
Download sequence
Identical sequences V9GZ14
ENSP00000477299 ENSP00000477299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]