SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000477572 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477572
Domain Number 1 Region: 86-313
Classification Level Classification E-value
Superfamily Heme oxygenase-like 3.86e-74
Family Eukaryotic type heme oxygenase 0.000000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477572   Gene: ENSG00000103415   Transcript: ENST00000613539
Sequence length 370
Comment pep:known chromosome:GRCh38:16:4496146:4510346:1 gene:ENSG00000103415 transcript:ENST00000613539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRSVAQAGVQWISLAHCSLHLLGSRDSPASASCVAGITGPEEREQQEPHPAAMSAEVE
TSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKEL
FKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQ
CPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQF
YLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLAR
ETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFILAAGVAL
AAGLLAWYYM
Download sequence
Identical sequences A0A087WT44
NP_001273196.1.87134 NP_001273196.1.92137 XP_011520775.1.92137 ENSP00000477572 ENSP00000480515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]