SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000477762 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477762
Domain Number 1 Region: 36-76
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.00000000127
Family MaoC-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477762   Gene: ENSG00000255154   Transcript: ENST00000474660
Sequence length 76
Comment pep:putative chromosome:GRCh38:3:58306272:58317842:1 gene:ENSG00000255154 transcript:ENST00000474660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLISSHHLWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVATFSELT
GDVNPLHLNEDFAKHT
Download sequence
Identical sequences A0A087WTC8 A0A2J8T1D3
ENSP00000477762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]