SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000477789 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000477789
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily ALDH-like 0.00000000000131
Family ALDH-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000477789   Gene: ENSG00000006534   Transcript: ENST00000616697
Sequence length 66
Comment pep:known chromosome:GRCh38:11:68018581:68021852:1 gene:ENSG00000006534 transcript:ENST00000616697 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
LALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAG
SASESG
Download sequence
Identical sequences A0A087WTE0 A0A2J8U0L6
ENSP00000477789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]