SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478080 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478080
Domain Number 1 Region: 68-112
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.71e-17
Family Ran binding protein zinc finger-like 0.00012
Further Details:      
 
Domain Number 2 Region: 24-80
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.00000000105
Family SWIB/MDM2 domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSP00000478080
Domain Number - Region: 213-259
Classification Level Classification E-value
Superfamily RING/U-box 0.0003
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478080   Gene: ENSG00000198625   Transcript: ENST00000612738
Sequence length 267
Comment pep:known chromosome:GRCh38:1:204516379:204558119:1 gene:ENSG00000198625 transcript:ENST00000612738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVIEVGKNDD
LEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLST
SDITAIPEKENEGNDVPDCRRTISAPVVRPKDAYIKKENSKLFDPCNSVEFLDLAHSSES
QETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHC
ARRLKKAGASCPICKKEIQLVIKVFIA
Download sequence
Identical sequences A0A087WTR9
ENSP00000478080 NP_001265448.1.87134 NP_001265448.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]