SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000478339 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478339
Domain Number 1 Region: 43-144
Classification Level Classification E-value
Superfamily Caspase-like 1.38e-35
Family Caspase catalytic domain 0.0000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478339   Gene: ENSG00000164305   Transcript: ENST00000613118
Sequence length 156
Comment pep:known chromosome:GRCh38:4:184627697:184648592:-1 gene:ENSG00000164305 transcript:ENST00000613118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDALIKVSMENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIIN
NKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKR
SSFVCVLLSHGEEGIIFGTNGPVDLKNNKLFQRGSL
Download sequence
Identical sequences ENSP00000478339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]