SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000478380 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478380
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-18
Family ALDH-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478380   Gene: ENSG00000006534   Transcript: ENST00000527514
Sequence length 71
Comment pep:putative chromosome:GRCh38:11:68021844:68024615:1 gene:ENSG00000006534 transcript:ENST00000527514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLALYAF
SNSSQERIPQR
Download sequence
Identical sequences A0A087WU54
ENSP00000478380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]