SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000478911 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000478911
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.85e-39
Family NadC C-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000478911   Gene: ENSG00000147813   Transcript: ENST00000460623
Sequence length 232
Comment pep:known chromosome:GRCh38:8:143574785:143576162:-1 gene:ENSG00000147813 transcript:ENST00000460623 gene_biotype:protein_coding transcript_biotype:non_stop_decay
Sequence
XFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAV
GGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQ
EPCTVRPAQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVGGRPTLSFCPVRPR
PHPAHRSCPLLPAGGAVREAAGPGEQSVCGAVPLRLGAGLTGNNTNHSLFPT
Download sequence
Identical sequences A0A087WUT5
ENSP00000478911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]