SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000479736 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479736
Domain Number 1 Region: 69-157
Classification Level Classification E-value
Superfamily DNA-binding domain 2.88e-30
Family Methyl-CpG-binding domain, MBD 0.00000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479736   Gene: ENSG00000169057   Transcript: ENST00000611468
Sequence length 168
Comment pep:known chromosome:GRCh38:X:154031307:154092293:-1 gene:ENSG00000169057 transcript:ENST00000611468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAET
SEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYL
INPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGREPLPARAETT
Download sequence
Identical sequences A0A087WVW7 A0A2J8INC3 A0A2J8RLQ8
ENSP00000479736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]