SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000479813 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479813
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 1.83e-39
Family Eukaryotic RPB5 N-terminal domain 0.00029
Further Details:      
 
Domain Number 2 Region: 115-183
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 8.24e-27
Family RPB5 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479813   Gene: ENSG00000099817   Transcript: ENST00000619917
Sequence length 184
Comment pep:putative chromosome:GRCh38:19:1088388:1095366:-1 gene:ENSG00000099817 transcript:ENST00000619917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQLVPE
HVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYR
LVHP
Download sequence
Identical sequences A0A087WVZ9
ENSP00000479813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]