SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000479948 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479948
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily ALDH-like 4.71e-49
Family ALDH-like 0.0000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479948   Gene: ENSG00000006534   Transcript: ENST00000615463
Sequence length 230
Comment pep:known chromosome:GRCh38:11:68010323:68028676:1 gene:ENSG00000006534 transcript:ENST00000615463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHPSKQRLPPPSWVFPLPASASSLSRSQP
Download sequence
Identical sequences Q9BUJ8
ENSP00000479948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]