SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000479988 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000479988
Domain Number 1 Region: 14-371
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.11e-88
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000479988   Gene: ENSG00000140400   Transcript: ENST00000618257
Sequence length 425
Comment pep:known chromosome:GRCh38:15:75355794:75359680:-1 gene:ENSG00000140400 transcript:ENST00000618257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPKPGGAHSLALVTVPSMGYAPVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVK
LDPTGRLTSLVLVASGREAIAEGAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAG
TLAVGTEGGLRGSAWFLLQISPNSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPA
RVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASV
RGSILSLSLLRAPKAPDATADTGRHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAP
SPAPATSWSAFSVSSPAVVLETVKQAESSPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEA
ILCDLLERPDPAGHLTSGQPPEAHLFSLPSAVPVARASASATLSPWGWGFVCRRLWGLLI
SASPA
Download sequence
Identical sequences A0A0C4DGU9
ENSP00000479988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]