SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000480589 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000480589
Domain Number 1 Region: 61-165
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-38
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 2 Region: 175-279
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-38
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 3 Region: 289-393
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-38
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 4 Region: 403-507
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-38
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 5 Region: 517-570
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-17
Family Kringle modules 0.0000843
Further Details:      
 
Domain Number 6 Region: 3-51
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000164
Family Kringle modules 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000480589   Gene: ENSG00000198670   Transcript: ENST00000614786
Sequence length 571
Comment pep:known chromosome:GRCh38:6:160617116:160640850:-1 gene:ENSG00000198670 transcript:ENST00000614786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSE
QAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMN
YCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQ
RPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPD
AVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQE
CYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPY
CYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNG
QSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDP
GVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGT
YSTTVTGRTCQAWSSMTPHSHSRTPEYYPNA
Download sequence
Identical sequences A0A087WWY0
ENSP00000480589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]