SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481048 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481048
Domain Number 1 Region: 74-253
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.38e-37
Family Ypt/Rab-GAP domain of gyp1p 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481048   Gene: ENSG00000275760   Transcript: ENST00000617600
Sequence length 291
Comment pep:known chromosome:GRCh38:CHR_HSCHR17_7_CTG4:36324255:36335130:1 gene:ENSG00000275760 transcript:ENST00000617600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVVEVAGSWWAQEREDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGIVHETELPPL
TAREAKQIRREISRKSKWVDMLGDWEKYKSSRKLIDRAYKGMPMNIRGPMWSVLLNIEEM
KLKNPGRYQIMKEKGKRSSEHIQRIDRDISGTLRKHMFFRDRYGTKQRELLHILLAYEEY
NPEVGYCRDLSHIAALFLLYLPEEDAFWALVQLLASERHSLQGFHSPNGGTVQGLQDQQE
HVVATSQPKTMGHQSASRRRPGVARGHVFATGSLIPGPGMRTLCSSILGPL
Download sequence
Identical sequences ENSP00000481048 ENSP00000484393 ENSP00000468205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]