SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000481051 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481051
Domain Number 1 Region: 321-502
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.89e-46
Family Hemopexin-like domain 0.00072
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.01e-44
Family Matrix metalloproteases, catalytic domain 0.0000522
Further Details:      
 
Domain Number 3 Region: 30-96
Classification Level Classification E-value
Superfamily PGBD-like 7.85e-16
Family MMP N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481051   Gene: ENSG00000271447   Transcript: ENST00000619655
Sequence length 510
Comment pep:known chromosome:GRCh38:17:35756250:35795707:-1 gene:ENSG00000271447 transcript:ENST00000619655 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFS
DAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRK
KRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLF
TDFETWDSYSPQGRRPETQGPKYCHSSFDAITVGSHFWEVAADGNVSEPRPLQERWVGLP
PNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDAALFFPPLRRL
ILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQ
AKLQATTSGRWATELPWMGCWHANSGSALF
Download sequence
Identical sequences B3KV06
ENSP00000481051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]