SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000481098 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481098
Domain Number 1 Region: 13-127
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.00000024
Family Haloperoxidase (bromoperoxidase) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481098   Gene: ENSG00000278373   Transcript: ENST00000612807
Sequence length 154
Comment pep:putative chromosome:GRCh38:CHR_HSCHR2_1_CTG7_2:168918280:168924720:1 gene:ENSG00000278373 transcript:ENST00000612807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRHAGGRGL
Download sequence
Identical sequences gi|126273546|ref|NP_001075155.1| NYSGRC-126273546 NP_001075155.1.87134 NP_001075155.1.92137 ENSP00000396939 ENSP00000481098 ENSP00000396939 ENSP00000459575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]