SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000481506 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481506
Domain Number 1 Region: 56-114
Classification Level Classification E-value
Superfamily Kringle-like 2.34e-19
Family Fibronectin type II module 0.0031
Further Details:      
 
Domain Number 2 Region: 175-220
Classification Level Classification E-value
Superfamily Kringle-like 2.28e-16
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 3 Region: 115-166
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000828
Family Fibronectin type II module 0.004
Further Details:      
 
Domain Number 4 Region: 24-68
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000657
Family Fibronectin type II module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481506   Gene: ENSG00000169393   Transcript: ENST00000619003
Sequence length 220
Comment pep:known chromosome:GRCh38:19:48008649:48025142:1 gene:ENSG00000169393 transcript:ENST00000619003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQLPVGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQW
KYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGN
SLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCH
FPFNYKNKNYFNCTNEGSKENLVWCATSYNYDQDHTWVYC
Download sequence
Identical sequences A0A087WY45
ENSP00000481506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]