SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000481672 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481672
Domain Number 1 Region: 21-155
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 4.32e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSP00000481672
Domain Number - Region: 162-276
Classification Level Classification E-value
Superfamily ALDH-like 0.0213
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481672   Gene: ENSG00000165283   Transcript: ENST00000619795
Sequence length 310
Comment pep:known chromosome:GRCh38:9:35099776:35103195:-1 gene:ENSG00000165283 transcript:ENST00000619795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLY
LRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAAD
CWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQI
LASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAF
SKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASL
DEELDRVKMS
Download sequence
Identical sequences A0A087WYB4 A0A2I2YJS9 A0A2I3STI3 A0A2J8T0R2
NP_001273962.1.87134 NP_001273962.1.92137 ENSP00000481672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]