SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000481855 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000481855
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 1.44e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 110-158
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.000000216
Family Glutamine synthetase catalytic domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000481855   Gene: ENSG00000135821   Transcript: ENST00000621524
Sequence length 233
Comment pep:known chromosome:GRCh38:1:182384338:182390539:-1 gene:ENSG00000135821 transcript:ENST00000621524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFQGPRVHITVVWEQTEPMAGTSWRPIT
GPACMLESRLRGLMPRSCLPSGNFRLDLVKESAWEIISGWPVSSCIVCVKTLE
Download sequence
Identical sequences ENSP00000481855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]