SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000482276 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000482276
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0019
Family Methyl-CpG-binding domain, MBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482276   Gene: ENSG00000071655   Transcript: ENST00000592965
Sequence length 34
Comment pep:putative chromosome:GRCh38:19:1585055:1592392:-1 gene:ENSG00000071655 transcript:ENST00000592965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVK
Download sequence
Identical sequences A0A087WZ12 A0A2J8J1V3 A0A2J8R9H8
ENSP00000482276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]