SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000482385 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482385
Domain Number 1 Region: 20-88
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-21
Family Hemopexin-like domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482385   Gene: ENSG00000271447   Transcript: ENST00000615317
Sequence length 89
Comment pep:putative chromosome:GRCh38:17:35756249:35768326:-1 gene:ENSG00000271447 transcript:ENST00000615317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPRP
LQERWVGLPPNIEAAAVSLNDGDFYFFKA
Download sequence
Identical sequences A0A087WZ56
ENSP00000482385 ENSP00000466671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]