SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000482721 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482721
Domain Number 1 Region: 219-491
Classification Level Classification E-value
Superfamily TPR-like 3.45e-29
Family Tetratricopeptide repeat (TPR) 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSP00000482721
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily TPR-like 0.00522
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number - Region: 159-221
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0557
Family Phosphate binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482721   Gene: ENSG00000165533   Transcript: ENST00000622513
Sequence length 505
Comment pep:known chromosome:GRCh38:14:88824624:88881078:1 gene:ENSG00000165533 transcript:ENST00000622513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQAAWILKARALTEMVYIDEIDVD
QEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG
RPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPK
LAKALFEYIFHHENDVKTALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKS
ALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSS
AAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCC
FYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNH
AEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQK
SEAAFPDHVDTQHLIKQLRQHFAML
Download sequence
Identical sequences A0A0C4DGY3
HR5649 ENSP00000482721 ENSP00000339486 gi|38146012|ref|NP_938051.1| NP_938051.1.87134 NP_938051.1.92137 XP_006720098.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]