SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000482758 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000482758
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily FKBP-like 1e-20
Family FKBP immunophilin/proline isomerase 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000482758   Gene: ENSG00000088832   Transcript: ENST00000614856
Sequence length 129
Comment pep:putative chromosome:GRCh38:20:1375293:1393164:-1 gene:ENSG00000088832 transcript:ENST00000614856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQVCSLICFVLLSSIYLLYFFIGGIFIRFKNKKSEKSHPHAIPSDQYPHKKLLLLM
FLVLWFKHI
Download sequence
Identical sequences A0A087WZM5
ENSP00000482758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]