SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483084 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483084
Domain Number 1 Region: 361-471,582-730
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.67e-51
Family Phosphate binding protein-like 0.000012
Further Details:      
 
Domain Number 2 Region: 1-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.81e-24
Family L-arabinose binding protein-like 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSP00000483084
Domain Number - Region: 489-575
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0141
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483084   Gene: ENSG00000152208   Transcript: ENST00000611049
Sequence length 926
Comment pep:known chromosome:GRCh38:4:93084986:93774553:1 gene:ENSG00000152208 transcript:ENST00000611049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDD
YTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVE
NNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIII
NEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNME
ISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVSGL
TGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGV
VLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQE
DGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFAC
LAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGG
EVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTEIPYGT
VLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVW
DAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPYRDVFSQRILELQQNGDMDILK
HKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAAGIVLSCFIAMLETWWNKRKGS
RVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISD
FRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKT
MSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences A0A087X043 A0A2J8MAF6
ENSPTRP00000027976 ENSPTRP00000027976 ENSP00000483084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]