SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483168 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483168
Domain Number 1 Region: 606-776
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 33-246
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 262-331,389-423
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 466-572
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000218
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483168   Gene: ENSG00000278741   Transcript: ENST00000611021
Sequence length 822
Comment pep:known chromosome:GRCh38:CHR_HSCHR17_2_CTG2:1003520:1113400:-1 gene:ENSG00000278741 transcript:ENST00000611021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEEEAIGLLDKVLEDEDVFLLEECELGTPTSPGSGSPFLVAVKVEAGKGLEMRKLVLS
GFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNL
CPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKV
KGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNF
LSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTS
AGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKAN
KGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKL
QKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFK
QSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKT
KVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTP
SKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAV
FDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCM
MHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLT
SAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences A0A2I2YTI8 K7CBL8
ENSP00000291107 ENSP00000480982 ENSP00000483168 NP_001083.2.87134 NP_001083.2.92137 XP_003816881.2.60992 XP_018868883.1.27298 ENSP00000291107 gi|38679954|ref|NP_001083.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]