SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000483183 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483183
Domain Number 1 Region: 3-169
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.81e-21
Family G proteins 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483183   Gene: ENSG00000214087   Transcript: ENST00000622299
Sequence length 173
Comment pep:novel chromosome:GRCh38:17:81681187:81683763:-1 gene:ENSG00000214087 transcript:ENST00000622299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLLGATGVGKTLLVKRLQEVSSRDGKGDLGEPPPTRPTVGTNLTDIVAQRKITIRELG
GCMGPIWSSYYGNCRSLLFVMDASDPTQLSASCVQLLGLLSAEQLAEASVLILFNKIDLP
CYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND
Download sequence
Identical sequences A0A2J8JG39 B4E3H0
ENSP00000483183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]